Iright
BRAND / VENDOR: Proteintech

Proteintech, 11180-2-AP, PCNP Polyclonal antibody

CATALOG NUMBER: 11180-2-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCNP (11180-2-AP) by Proteintech is a Polyclonal antibody targeting PCNP in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 11180-2-AP targets PCNP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information PCNP can be detected as 24-28 kDa after posttranslational modification. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1663 Product name: Recombinant human PCNP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC013916 Sequence: MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISKFGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDGYTNISWTKLLQ Predict reactive species Full Name: PEST proteolytic signal containing nuclear protein Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC013916 Gene Symbol: PCNP Gene ID (NCBI): 57092 RRID: AB_2160652 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WW12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924