Iright
BRAND / VENDOR: Proteintech

Proteintech, 11186-1-AP, CPNE3 Polyclonal antibody

CATALOG NUMBER: 11186-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CPNE3 (11186-1-AP) by Proteintech is a Polyclonal antibody targeting CPNE3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11186-1-AP targets CPNE3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, A431 cells, HeLa cells, HepG2 cells, HuH-7 cells, Y79 cells Positive IP detected in: HepG2 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Copines are a family of evolutionarily conserved calcium-dependent phospholipid-binding proteins (PMID: 9430674). They contain two Ca(2+)- and phospholipid-binding domains known as C2 domains. Copines are potentially involved in regulating membrane trafficking and in protein-protein interactions. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1634 Product name: Recombinant human CPNE3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-537 aa of BC036242 Sequence: EASRSSPVEFECINEKKRQKKKSYKNSGVISVKQCEITVECTFLDYIMGGCQLNFTVGVDFTGSNGDPRSPDSLHYISPNGVNEYLTALWSVGLVIQDYDADKMFPAFGFGAQIPPQWQVSHEFPMNFNPSNPYCNGIQGIVEAYRSCLPQIKLYGQTNFSPIINHVARFAAAATQQQTASRYFVLLIITDGVITDLDETRQAIVNASRLPMSIIIVGVGGADFSAMEFLDGDGGSLHSPLGEVAIRDIVQFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPATKQQKQ Predict reactive species Full Name: copine III Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC036242 Gene Symbol: CPNE3 Gene ID (NCBI): 8895 RRID: AB_2084214 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75131 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924