Iright
BRAND / VENDOR: Proteintech

Proteintech, 11195-1-AP, SRP9 Polyclonal antibody

CATALOG NUMBER: 11195-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SRP9 (11195-1-AP) by Proteintech is a Polyclonal antibody targeting SRP9 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11195-1-AP targets SRP9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, A2780 cells, HeLa cells, MCF-7 cells, SKOV-3 cells, mouse colon tissue, HuH-7 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Signal recognition particle 9(SRP9) is component of the signal recognition particle (SRP), which is a ribonucleoprotein complex that mediates the targeting of proteins to the rough endoplasmic reticulum (ER). SRP9 form a heterodimer with SRP14, which involves in arrest of the elongation of the nescent chains during targeting to ensure efficient translocation of the preprotein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1683 Product name: Recombinant human SRP9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC015094 Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE Predict reactive species Full Name: signal recognition particle 9kDa Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC015094 Gene Symbol: SRP9 Gene ID (NCBI): 6726 RRID: AB_2239820 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49458 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924