Product Description
Size: 20ul / 150ul
The FXYD2 (11198-1-AP) by Proteintech is a Polyclonal antibody targeting FXYD2 in WB, IHC, ELISA applications with reactivity to human, rat samples
11198-1-AP targets FXYD2 in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples.
Tested Applications
Positive WB detected in: human kidney tissue, MOLT-4 cells
Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:5000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Background Information
FXYD2 (FXYD domain-containing ion transport regulator 2), also known as the gamma-subunit of the NaK-ATPase, belongs to the FXYD family which has been proposed to be the regulators of Na, K-ATPase function by lowering affinities of the system for potassium and sodium. The expression of FXYD2 is most abundant in kidney, while it is also detected in several other tissues like placenta, pancreas, and dorsal root ganglia (DRGs). Three splice variants of FXYD2 have been reported in mouse kidney, namely FXYD2 γa, -γb,and -γc. FXYD2 γa has been identified as a pancreatic beta cell-specific biomarker. This antibody can recognize all three isoforms of FXYD2.
Specification
Tested Reactivity: human, rat
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag1676 Product name: Recombinant human FXYD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC013289 Sequence: MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP Predict reactive species
Full Name: FXYD domain containing ion transport regulator 2
Calculated Molecular Weight: 7 kDa
Observed Molecular Weight: 7-10 kDa
GenBank Accession Number: BC013289
Gene Symbol: FXYD2
Gene ID (NCBI): 486
RRID: AB_2108309
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P54710
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924