Proteintech, 11209-1-AP, Pancreatic Lipase Polyclonal antibody

Size: 20ul / 150ul The Pancreatic Lipase (11209-1-AP) by Proteintech is a Polyclonal antibody targeting Pancreatic Lipase in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11209-1-AP targets Pancreatic Lipase in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, BxPC-3 cells, human pancreas tissue, rat pancreas tissue Positive IHC detected in: mouse pancreas tissue, human pancreas cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information The pancreatic triacylglycerol lipase precursor (PNLIP), a 56 kDa protein secreted by the pancreas that is essential for the hydrolysis and absorption of long-chain triglyceride fatty acids in the intestine is located ~1 Mb upstream from the chromosome 10 peak(PMID:17890784). It is also named as PL, PTL and belongs to the AB hydrolase superfamily. It may potentially be involved in the pathophysiology of traumatic brain injury and may be implicated in the proliferation of astrocytes and the recovery of neurological outcomes(PMID:19760487). The full length protein has a signal peptide with 16 amino acid and a glycosylation site. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1681 Product name: Recombinant human PNLIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 116-465 aa of BC014309 Sequence: VNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC Predict reactive species Full Name: pancreatic lipase Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 48-52 kDa GenBank Accession Number: BC014309 Gene Symbol: Pancreatic Lipase Gene ID (NCBI): 5406 RRID: AB_2167443 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16233 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.