Iright
BRAND / VENDOR: Proteintech

Proteintech, 11211-1-AP, CRIPT Polyclonal antibody

CATALOG NUMBER: 11211-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRIPT (11211-1-AP) by Proteintech is a Polyclonal antibody targeting CRIPT in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11211-1-AP targets CRIPT in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells Positive IP detected in: L02 cells Positive IF/ICC detected in: L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information The clustering and immobilization of receptors and ion channels located at specific subcellular sites are believed to be mediated by intracellular proteins that attach these membrane proteins to the cytoskeleton. Receptors and ion channels interact with cytoplasmic proteins, which involved in the modulation or downstream signaling mechanisms of the receptor/ion channel. CRIPT is the protein that binds to the third PDZ (PDZ3) domain of PSD95, which binds to and clusters a variety of membrane proteins, including Shaker-type potassium channel subunits and NMDA receptor NR2 subunits, via its first 2 N-terminal PDZ domains Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1708 Product name: Recombinant human CRIPT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC018653 Sequence: MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV Predict reactive species Full Name: cysteine-rich PDZ-binding protein Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC018653 Gene Symbol: CRIPT Gene ID (NCBI): 9419 RRID: AB_2084731 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P021 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924