Proteintech, 11221-1-AP, CXCL3/GRO Gamma Polyclonal antibody

Size: 20ul / 150ul The CXCL3/GRO Gamma (11221-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL3/GRO Gamma in WB, ELISA applications with reactivity to human samples 11221-1-AP targets CXCL3/GRO Gamma in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LPS and Protein transport inhibitor treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CXC chemokine ligand 3 (CXCL3) is a member of CXC-type chemokine family that is identified as a major regulator in immune and inflammation responses. CXCL3 is broadly expressed in various human tumor types, and it is also known to play a critical role in mediating tumor development and progression. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1732 Product name: Recombinant human CXCL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC016308 Sequence: MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN Predict reactive species Full Name: chemokine (C-X-C motif) ligand 3 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 8-10 kDa GenBank Accession Number: BC016308 Gene Symbol: CXCL3 Gene ID (NCBI): 2921 RRID: AB_3669124 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19876 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.