Iright
BRAND / VENDOR: Proteintech

Proteintech, 11244-1-AP, AASDHPPT Polyclonal antibody

CATALOG NUMBER: 11244-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AASDHPPT (11244-1-AP) by Proteintech is a Polyclonal antibody targeting AASDHPPT in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11244-1-AP targets AASDHPPT in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AASDHPPT, also known as L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, is required for mitochondrial respiration and oxidative metabolism via the mitochondrial fatty acid synthesis (mtFAS) pathway. AASDHPPT catalyzes the post-translational modification of target proteins by phosphopantetheine and transfer the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, including the acyl carrier domain of FASN. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1763 Product name: Recombinant human AASDHPPT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-309 aa of BC016728 Sequence: MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS Predict reactive species Full Name: aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC016728 Gene Symbol: AASDHPPT Gene ID (NCBI): 60496 RRID: AB_2304862 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRN7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924