Proteintech, 11254-1-AP, GLRX3 Polyclonal antibody

Size: 20ul / 150ul The GLRX3 (11254-1-AP) by Proteintech is a Polyclonal antibody targeting GLRX3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11254-1-AP targets GLRX3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, MCF7 cells, mouse testis tissue, rat testis tissue Positive IHC detected in: human stomach cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GLRX3(Glutaredoxin-3) is also named as PICOT, TXNL2. Mammalian glutaredoxin 3 is an essential protein involved in the regulation of signal transduction, for instance during immune cell activation and development of cardiac hypertrophy, presumably in response to redox signals(PMID:20226171). Glrx3 could take a pivotal role in colon and lung cancer cells during the tumorigenesis, which is expressed in lung and colon cancers consistently and preferentially(PMID:19797004). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1775 Product name: Recombinant human GLRX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC014372 Sequence: AQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLSSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN Predict reactive species Full Name: glutaredoxin 3 Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC014372 Gene Symbol: GLRX3 Gene ID (NCBI): 10539 RRID: AB_2110374 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O76003 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.