Proteintech, 11265-1-AP, CD31 Polyclonal antibody

Size: 20ul / 150ul The CD31 (11265-1-AP) by Proteintech is a Polyclonal antibody targeting CD31 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human samples 11265-1-AP targets CD31 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood platelets, HUVEC cells, Jurkat cells, THP-1 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human liver cancer tissue, human tonsillitis tissue, human placenta tissue, human renal cell carcinoma tissue, human hepatocirrhosis tissue, human kidney tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human endometrial cancer tissue, human tonsillitis tissue Positive IF/ICC detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489). Specification Tested Reactivity: human Cited Reactivity: human, pig, rabbit, canine, monkey, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1787 Product name: Recombinant human CD31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 428-738 aa of BC022512 Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT Predict reactive species Full Name: platelet/endothelial cell adhesion molecule Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC022512 Gene Symbol: CD31 Gene ID (NCBI): 5175 ENSEMBL Gene ID: ENSG00000261371 RRID: AB_2299349 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16284 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.