Proteintech, 11271-1-AP, RPL13 Polyclonal antibody

Size: 20ul / 150ul The RPL13 (11271-1-AP) by Proteintech is a Polyclonal antibody targeting RPL13 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11271-1-AP targets RPL13 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, SGC-7901 cells, human lung tissue Positive IP detected in: HeLa cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information The mammalian ribosome comprises 79 ribosomal proteins and four rRNAs, which combine in equimolar ratios to form the small (40S) and large (60S) subunits. Ribosome proteins are a direct and critical target of the PI3K pathway in promoting growth.[PMID:15289434]. RPL13 may be a plausible candidate tumor suppressor gene, as knocking down L13 expression using small interfering RNA (siRNA) resulted in drastic attenuation of cancer cell growth with significant G1 and G2/M arrest of the cell cycle[PMID:16786168]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1814 Product name: Recombinant human RPL13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC014167 Sequence: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKA Predict reactive species Full Name: ribosomal protein L13 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC014167 Gene Symbol: RPL13 Gene ID (NCBI): 6137 RRID: AB_2269735 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P26373 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.