Proteintech, 11295-1-AP, SPIRE1 Polyclonal antibody

Size: 20ul / 150ul The SPIRE1 (11295-1-AP) by Proteintech is a Polyclonal antibody targeting SPIRE1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 11295-1-AP targets SPIRE1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, SH-SY5Y cells Positive IHC detected in: human lung cancer tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SPIRE1, Protein spire homolog 1, belongs to the family of Wiskott-Aldrich homology region-2 (WH2) proteins (PMID: 11747823). SPIRE1 acts as an actin nucleation factor, associated with the slow-growing pointed end of the new filament (PMID: 11747823, PMID: 21620703). SPIRE1 and FMN2 promote assembly of nuclear actin filaments in response to DNA damage in order to facilitate movement of chromatin and repair factors after DNA damage (PMID: 26287480). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1798 Product name: Recombinant human SPIRE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 600-756 aa of BC016825 Sequence: GRFSFFTWSYTCQFCKRPVCSQCCKKMRLPSKPYSTLPIFSLGPSALQRGESSMRSEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI Predict reactive species Full Name: spire homolog 1 (Drosophila) Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 50-60 kDa, 95 kDa GenBank Accession Number: BC016825 Gene Symbol: SPIRE1 Gene ID (NCBI): 56907 RRID: AB_3085370 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q08AE8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.