Proteintech, 11296-2-AP, EIF2B3 Polyclonal antibody

Size: 20ul / 150ul The EIF2B3 (11296-2-AP) by Proteintech is a Polyclonal antibody targeting EIF2B3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 11296-2-AP targets EIF2B3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1809 Product name: Recombinant human EIF2B3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-232 aa of BC018728 Sequence: GSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGPETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEG Predict reactive species Full Name: eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa Calculated Molecular Weight: 44 kDa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC018728 Gene Symbol: EIF2B3 Gene ID (NCBI): 8891 RRID: AB_2096142 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NR50 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.