Iright
BRAND / VENDOR: Proteintech

Proteintech, 11334-1-AP, PTPN1/PTP1B Polyclonal antibody

CATALOG NUMBER: 11334-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PTPN1/PTP1B (11334-1-AP) by Proteintech is a Polyclonal antibody targeting PTPN1/PTP1B in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11334-1-AP targets PTPN1/PTP1B in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Sp2/0 cells, HeLa cells, mouse liver tissue, THP-1 cells, Jurkat cells, C6 cells, NIH/3T3 cells, rat liver tissue, mouse placenta tissue Positive IP detected in: A431 cells Positive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PTPN1 (protein tyrosine phosphatase, non-receptor type 1) is also named as PTP1B or PTP-1B, and belongs to the protein-tyrosine phosphatase family and non-receptor class 1 subfamily. PTPN1 is involved in the regulation of several important physiological pathways, which regulates both INS and leptin signaling, and interacts with the epidermal-and platelet-derived growth factor receptors (PMID: 20101100). The gene might harbor variants influencing susceptibility to INS resistance and type 2 diabetes (PMID:15919813). The molecular mass of PTPN1 is 50 kDa, but sometimes some truncated forms can be detected as 48, 46, 39, 37 kDa due to non-specific proteolytic cleavage of PTP1B in different cells (PMID: 18253097). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1878 Product name: Recombinant human PTPN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-435 aa of BC015660 Sequence: MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT Predict reactive species Full Name: protein tyrosine phosphatase, non-receptor type 1 Calculated Molecular Weight: 435 aa, 50 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC015660 Gene Symbol: PTP1B Gene ID (NCBI): 5770 RRID: AB_10642566 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18031 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924