Proteintech, 11367-1-AP, NCKIPSD Polyclonal antibody

Size: 20ul / 150ul The NCKIPSD (11367-1-AP) by Proteintech is a Polyclonal antibody targeting NCKIPSD in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 11367-1-AP targets NCKIPSD in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, fetal human brain tissue, human heart tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1915 Product name: Recombinant human NCKIPSD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 366-715 aa of BC016052 Sequence: GQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEGVIRCYLEELLHILTDADPEVCKKMCKRNEFESVLALVAYYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLNRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQAILRRILNEEETSPQCQMDRMIVREMCKEFLVLGEAPS Predict reactive species Full Name: NCK interacting protein with SH3 domain Calculated Molecular Weight: 715 aa, 78 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC016052 Gene Symbol: NCKIPSD Gene ID (NCBI): 51517 RRID: AB_2150732 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZQ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.