Iright
BRAND / VENDOR: Proteintech

Proteintech, 11368-1-AP, TIN2 Polyclonal antibody

CATALOG NUMBER: 11368-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TIN2 (11368-1-AP) by Proteintech is a Polyclonal antibody targeting TIN2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 11368-1-AP targets TIN2 in WB, IF/ICC, chip, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information TIN2, also named as TINF2, is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. TIN2 has some isoforms with MW 50 kDa (TIN2L), 40 kDa (TIN2S) and 13 kDa. This antibody detects TIN2L, TIN2S and the shelterin complex. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1922 Product name: Recombinant human TIN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-451 aa of BC005030 Sequence: LFEYLCQLEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRLALHNPLPKAKPGTHLPQGPSSRTHPEPLAGRHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISKPESKEEHAIYTADLAMGTRAASTGKSKSPCQTLGGRALKENPVDLPATEQKENCLDCYMDPLRLSLLPPRARKPVCPPSLCSSVITIGDLVLDSDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCRDSSRPL Predict reactive species Full Name: TERF1 (TRF1)-interacting nuclear factor 2 Calculated Molecular Weight: 451 aa, 50 kDa Observed Molecular Weight: 50 kDa, 40 kDa GenBank Accession Number: BC005030 Gene Symbol: TINF2 Gene ID (NCBI): 26277 RRID: AB_2205100 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSI4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924