Iright
BRAND / VENDOR: Proteintech

Proteintech, 11390-1-AP, PWP2 Polyclonal antibody

CATALOG NUMBER: 11390-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PWP2 (11390-1-AP) by Proteintech is a Polyclonal antibody targeting PWP2 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 11390-1-AP targets PWP2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information The function of PWP2 remains largely unknown. Catalog#11390-1-AP is a rabbit polyclonal antibody raised against the full-length of human PWP2. The MW of this protein is 102 kDa, and this antibody specially recognises the 102 kDa protein. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1936 Product name: Recombinant human PWP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 520-919 aa of BC014988 Sequence: SWDKTVRLWDMFDSWRTKETLALTSDALAVTIRPDGAELAVATLNSQITFWDPENAVQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRKMTEFGNLALIDQDAGQEDGVAIPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATTTEGLLIYSLDTRVLFDPFELDTSVTPGRVREALRQQDFTRAILMALRLNESKLVQEALEAVPRGEIEVVTSSLPELYVEKVLEFLASSFEVSRHLEFYLLWTHKLLMLHGQKLKSRAGTLLPVIQFLQKSIQRHLDDLSKLCSWNHYNMQYALAVSKQRGTKRSLDPLGSEEEAEASEDDSLHLLGGGGRDSEEEMLA Predict reactive species Full Name: PWP2 periodic tryptophan protein homolog (yeast) Calculated Molecular Weight: 919 aa, 102 kDa Observed Molecular Weight: 102 kDa GenBank Accession Number: BC014988 Gene Symbol: PWP2 Gene ID (NCBI): 5822 RRID: AB_2284709 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15269 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924