Proteintech, 11396-1-AP, RPH3A Polyclonal antibody

Size: 20ul / 150ul The RPH3A (11396-1-AP) by Proteintech is a Polyclonal antibody targeting RPH3A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11396-1-AP targets RPH3A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, human brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RAB3A is a small G protein that is thought to act in exocytosis of neurotransmitters and hormones in synaptic neurotransmission and cell-cell communication. RPH3A (RPH3A), a RAB3A effector, is a neuronal C2 domain tandem containing protein that is involved in the neuronal transmitter process. Huntington's disease (HD) is a hereditary neurodegenerative disorder characterized by progressive motor disturbances, cognitive defects and dementia. Level of rabphilin 3A is substantially decreased in synapses of most brain regions in R6/1 transgenic mouse model of HD suggesting a role of RPH3A in impaired synaptic transmission. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1956 Product name: Recombinant human RPH3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC017259 Sequence: MTDTVFSNSSNRWMYPSDRPLQSKLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVETNNRLHSVWLCKICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQPVSEPAAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGNYGPPVRRASEARMSSSSRDSESWDHSGGAGDSSRSPAGLRRANSVQASRPAPGSVQSPAPPQPGQPGTPGGSRPGP Predict reactive species Full Name: rabphilin 3A homolog (mouse) Calculated Molecular Weight: 690 aa, 76 kDa Observed Molecular Weight: 76 kDa GenBank Accession Number: BC017259 Gene Symbol: RPH3A Gene ID (NCBI): 22895 RRID: AB_2181145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2J0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.