Iright
BRAND / VENDOR: Proteintech

Proteintech, 11403-1-AP, MELK Polyclonal antibody

CATALOG NUMBER: 11403-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MELK (11403-1-AP) by Proteintech is a Polyclonal antibody targeting MELK in WB, IHC, ELISA applications with reactivity to human, mouse samples 11403-1-AP targets MELK in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, K-562 cells Positive IHC detected in: human breast cancer tissue, mouse colon tissue, mouse kidney tissue, human lung cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MELK is involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. It also plays a key role in cell proliferation and carcinogenesis, and it is required for proliferation of embryonic and postnatal multipotent neural progenitors. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1897 Product name: Recombinant human MELK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-651 aa of BC014039 Sequence: EDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV Predict reactive species Full Name: maternal embryonic leucine zipper kinase Calculated Molecular Weight: 651 aa, 75 kDa Observed Molecular Weight: 50-70 kDa GenBank Accession Number: BC014039 Gene Symbol: MELK Gene ID (NCBI): 9833 RRID: AB_2877762 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14680 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924