Proteintech, 11404-1-AP, NDOR1/NR1 Polyclonal antibody

Size: 20ul / 150ul The NDOR1/NR1 (11404-1-AP) by Proteintech is a Polyclonal antibody targeting NDOR1/NR1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11404-1-AP targets NDOR1/NR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HaCaT cells, human liver tissue, human spleen tissue, human lung tissue, mouse thymus tissue, mouse testis tissue, HeLa cells, Jurkat cells, U-251 cells, NIH/3T3 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1909 Product name: Recombinant human NDOR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 248-597 aa of BC015735 Sequence: VLIQPSNSAAHVQRFCQVLGLDPDQLFMLQPREPDVSSPTRLPQPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDFPHTAAAIPPDYLLDLIPVIRPRAFSIASSLLTHPSRLQILVAVVQFQTRLKEPRRGLCSSWLASLDPGQGPVRVPLWVRPGSLAFPETPDTPVIMVGPGTGVAPFRAAIQERVAQGQTGNFLFFGCRWRDQDFYWEAEWQELEKRDCLTLIPAFSREQEQKIYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTETWA Predict reactive species Full Name: NADPH dependent diflavin oxidoreductase 1 Calculated Molecular Weight: 606 aa, 68 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC015735 Gene Symbol: NDOR1 Gene ID (NCBI): 27158 RRID: AB_2251225 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHB4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.