Proteintech, 11413-1-AP, COX7A1 Polyclonal antibody

Size: 20ul / 150ul The COX7A1 (11413-1-AP) by Proteintech is a Polyclonal antibody targeting COX7A1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 11413-1-AP targets COX7A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, human brain tissue, human kidney tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Cytochrome c oxidase(COX) catalyzes the transfer of electrons from reduced cytochrome c to molecular oxygen. Subunit VIIa of mammalian COX exists in at least 2 isoforms, liver and muscle. COX7A1(Cytochrome c oxidase subunit 7A1, mitochondrial) is also named as COX7AH, cytochrome c oxidase subunit VIIa-H, cytochrome c oxidase subunit VIIa-M and is the muscle isoform of COX subunit VIIa. Northern-blot analysis of primate tissues demonstrated that COXVIIa-M mRNA is present only in muscle tissues(PMID:1327965). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1981 Product name: Recombinant human COX7A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC002757 Sequence: MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN Predict reactive species Full Name: cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) Calculated Molecular Weight: 79 aa, 9 kDa Observed Molecular Weight: 7-9 kDa GenBank Accession Number: BC002757 Gene Symbol: COX7A1 Gene ID (NCBI): 1346 RRID: AB_2085705 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24310 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.