Proteintech, 11414-1-AP, C1QTNF3 Polyclonal antibody

Size: 20ul / 150ul The C1QTNF3 (11414-1-AP) by Proteintech is a Polyclonal antibody targeting C1QTNF3 in IHC, ELISA applications with reactivity to human, mouse, rat samples 11414-1-AP targets C1QTNF3 in IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human kidney tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1958 Product name: Recombinant human C1QTNF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-246 aa of BC016021 Sequence: IAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAEGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK Predict reactive species Full Name: C1q and tumor necrosis factor related protein 3 Calculated Molecular Weight: 319 aa, 35 kDa GenBank Accession Number: BC016021 Gene Symbol: C1QTNF3 Gene ID (NCBI): 114899 RRID: AB_2877763 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXJ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.