Proteintech, 11417-2-AP, COX7B Polyclonal antibody

Size: 20ul / 150ul The COX7B (11417-2-AP) by Proteintech is a Polyclonal antibody targeting COX7B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11417-2-AP targets COX7B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, MCF-7 cells, rat brain tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information COX7B, also named as Cytochrome c oxidase subunit 7B, mitochondrial, is a 80 amino acid protein, which belongs to the cytochrome c oxidase VIIb family. COX7B protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX7B plays a role in proper central nervous system development in vertebrates. COX7B as a terminal enzyme in the mitochondrial respiratory chain (oxidative phosphorylation OXPHOS), catalyzing the electron transfer from reduced cytochrome c to molecule oxygen and plays a role in eye development. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1988 Product name: Recombinant human COX7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC018386 Sequence: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ Predict reactive species Full Name: cytochrome c oxidase subunit VIIb Calculated Molecular Weight: 80 aa, 9 kDa Observed Molecular Weight: 9 kDa GenBank Accession Number: BC018386 Gene Symbol: COX7B Gene ID (NCBI): 1349 RRID: AB_2085709 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24311 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.