Iright
BRAND / VENDOR: Proteintech

Proteintech, 11425-1-AP, COX6B1 Polyclonal antibody

CATALOG NUMBER: 11425-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COX6B1 (11425-1-AP) by Proteintech is a Polyclonal antibody targeting COX6B1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 11425-1-AP targets COX6B1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, Caco-2 cells, HeLa cells, HepG2 cells Positive IHC detected in: human liver cancer tissue, human gliomas tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information COX6B1 (Cytochrome c oxidase subunit 6B1) is also named as COX6B and belongs to the cytochrome c oxidase subunit 6B family. It connects the two COX monomers into the physiological dimeric form. Defects in COX6B1 are a cause of mitochondrial complex IV deficiency (MT-C4D). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1984 Product name: Recombinant human COX6B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC001015 Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI Predict reactive species Full Name: cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous) Calculated Molecular Weight: 80 aa, 10 kDa Observed Molecular Weight: 10-13 kDa GenBank Accession Number: BC001015 Gene Symbol: COX6B1 Gene ID (NCBI): 1340 RRID: AB_2085449 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14854 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924