Iright
BRAND / VENDOR: Proteintech

Proteintech, 11437-1-AP, COX6B2 Polyclonal antibody

CATALOG NUMBER: 11437-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COX6B2 (11437-1-AP) by Proteintech is a Polyclonal antibody targeting COX6B2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11437-1-AP targets COX6B2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information COX6B2(Cytochrome c oxidase subunit 6B2) encodes the testis-specific cytochrome C oxidase subunit VIb. It has been shown to be expressed in a subset of lung and breast tumors at a level >1% of the testicular level of expression(PMID: 24491090). It belongs to the cytochrome c oxidase subunit 6B family. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1983 Product name: Recombinant human COX6B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC064548 Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI Predict reactive species Full Name: cytochrome c oxidase subunit VIb polypeptide 2 (testis) Calculated Molecular Weight: 88 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC064548 Gene Symbol: COX6B2 Gene ID (NCBI): 125965 RRID: AB_10859092 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6YFQ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924