Iright
BRAND / VENDOR: Proteintech

Proteintech, 11460-1-AP, COX6A1 Polyclonal antibody

CATALOG NUMBER: 11460-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COX6A1 (11460-1-AP) by Proteintech is a Polyclonal antibody targeting COX6A1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11460-1-AP targets COX6A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, NIH/3T3 cells, rat liver tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information COX6A1(Cytochrome c oxidase subunit 6A1, mitochondrial) is also named as COX6AL and belongs to the cytochrome c oxidase subunit 6A family.This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2006 Product name: Recombinant human COX6A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC007723 Sequence: MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE Predict reactive species Full Name: cytochrome c oxidase subunit VIa polypeptide 1 Calculated Molecular Weight: 85 aa, 9 kDa Observed Molecular Weight: 9.5 kDa GenBank Accession Number: BC007723 Gene Symbol: COX6A1 Gene ID (NCBI): 1337 RRID: AB_2085445 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12074 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924