Proteintech, 11526-1-AP, MEPCE Polyclonal antibody

Size: 20ul / 150ul The MEPCE (11526-1-AP) by Proteintech is a Polyclonal antibody targeting MEPCE in WB, IHC, ELISA applications with reactivity to human samples 11526-1-AP targets MEPCE in WB, IP, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, K-562 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information MEPCE is a Component of the 7SK snRNP complex, and a S-adenosyl-L-methionine-dependent methyltransferase that adds a methylphosphate cap at the 5'-end of 7SK snRNA, which leads to its stabilization. Specification Tested Reactivity: human Cited Reactivity: human, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2092 Product name: Recombinant human MEPCE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 369-689 aa of BC018935 Sequence: SSKSEAGARGGGQGSKEKGRGSWGGRHHHHHPLPAAGFKKQQRKFQYGNYCKYYGYRNPSCEDGRLRVLKPEWFRGRDVLDLGCNVGHLTLSIACKWGPSRMVGLDIDSRLIHSARQNIRHYLSEELRLPPQTLEGDPGAEGEEGTTTVRKRSCFPASLTASRGPIAAPQVPLDGADTSVFPNNVVFVTGNYVLDRDDLVEAQTPEYDVVLCLSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYGKRKTLTETIYKNYYRIQLKPEQFSSYLTSPDVGFSSYELVATPHNTSKGFQRPVYLFHKARSPSH Predict reactive species Full Name: methylphosphate capping enzyme Calculated Molecular Weight: 689 aa, 74 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC018935 Gene Symbol: MEPCE Gene ID (NCBI): 56257 RRID: AB_2143568 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L2J0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.