Iright
BRAND / VENDOR: Proteintech

Proteintech, 11527-1-AP, UCHL5 Polyclonal antibody

CATALOG NUMBER: 11527-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UCHL5 (11527-1-AP) by Proteintech is a Polyclonal antibody targeting UCHL5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11527-1-AP targets UCHL5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse brain tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information UCHL5 (Ubiquitin carboxyl-terminal hydrolase isozyme L5) is also named as UCH37 and belongs to the peptidase C12 family. It is functionally linked with multiple protein complexes and signal transduction pathways. UCH37's weight average molecular weight increases as a function of its concentration. By size-exclusion chromatography, the apparent molecular weight of UCH37 was 51, 56, 70, and 109 kDa at 0.15, 0.69, 2.4, and 9.5 mg/mL, respectively. Given UCH37's monomeric molecular weight of 37 kDa and its apparent elongated shape, its tendency toward an apparent molecular weight between 40 and 50 kDa at decreasing concentrations is appropriate for UCH37 monomers (PMID:21953935). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2095 Product name: Recombinant human UCHL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-326 aa of BC025369 Sequence: MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTLLGK Predict reactive species Full Name: ubiquitin carboxyl-terminal hydrolase L5 Calculated Molecular Weight: 326 aa, 37 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC025369 Gene Symbol: UCHL5 Gene ID (NCBI): 51377 RRID: AB_2877774 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5K5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924