Iright
BRAND / VENDOR: Proteintech

Proteintech, 11555-1-AP, PYGO2 Polyclonal antibody

CATALOG NUMBER: 11555-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PYGO2 (11555-1-AP) by Proteintech is a Polyclonal antibody targeting PYGO2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11555-1-AP targets PYGO2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MDA-MB-453s cells, C6 cells, HeLa cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information PYGO2, also named as Pygopus homolog 2, is a 406 animo acid protein, which contains 1 PHD-type zinc finger. PYGO2 is involved in signal transduction through the Wnt pathway and Binds to BCL9 via the PHD-type zinc finger motif, and thereby becomes part of the nuclear beta-catenin/TCF complex. PYGO2 is in a high proportion of breast and epithelial ovarian malignant tumors and is required for the growth of several cell lines derived from these carcinomas. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2111 Product name: Recombinant human PYGO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-406 aa of BC032099 Sequence: FGGFRVQGGMAGQVPPGYSTGGGGGPQPLRRQPPPFPPNPMGPAFNMPPQGPGYPPPGNMNFPSQPFNQPLGQNFSPPSGQMMPGPVGGFGPMISPTMGQPPRAELGPPSLSQRFAQPGAPFGPSPLQRPGQGLPSLPPNTSPFPGPDPGFPGPGGEDGGKPLNPPASTAFPQEPHSGSPAAAVNGNQPSFPPNSSGRGGGTPDANSLAPPGKAGGGSGPQPPPGLVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEIQSVYIREGMGQLVAANDG Predict reactive species Full Name: pygopus homolog 2 (Drosophila) Calculated Molecular Weight: 406 aa, 41 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC032099 Gene Symbol: PYGO2 Gene ID (NCBI): 90780 RRID: AB_2877776 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924