Iright
BRAND / VENDOR: Proteintech

Proteintech, 11564-1-AP, BMSC UbP Polyclonal antibody

CATALOG NUMBER: 11564-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BMSC UbP (11564-1-AP) by Proteintech is a Polyclonal antibody targeting BMSC UbP in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11564-1-AP targets BMSC UbP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, HeLa cells, HepG2 cells, Jurkat cells, rat testis tissue Positive IP detected in: HeLa cells Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Ubiquitin is an important cellular signal that targets proteins for degradation or regulates their functions. UBL7 (ORF name SB132) encodes ubiquitin-like protein7 also named bone marrow stromal cell ubiquitin-like protein (BMSC-UbP) capable of binding ubiquitin. BMSC-UbP protein is derived from bone marrow stromal cells containing a ubiquitin-associated (UBA) domain at the C terminus that has been implicated in linking cellular processes and the ubiquitin system. BMSC-UbP mRNA is widely expressed in human multiple tissues and various tumor cell lines and is decreased in BMSC stimulated with phorbol myristate acetate (PMA) suggesting a role in regulation of BMSC function. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2130 Product name: Recombinant human UBL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-380 aa of BC030055 Sequence: MSLSDWHLAVKLADQPLTPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAAMREFRVLHTALHSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPNTRSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP Predict reactive species Full Name: ubiquitin-like 7 (bone marrow stromal cell-derived) Calculated Molecular Weight: 380 aa, 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC030055 Gene Symbol: UBL7 Gene ID (NCBI): 84993 RRID: AB_2212080 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96S82 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924