Iright
BRAND / VENDOR: Proteintech

Proteintech, 11601-1-AP, IGF2BP2 Polyclonal antibody

CATALOG NUMBER: 11601-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IGF2BP2 (11601-1-AP) by Proteintech is a Polyclonal antibody targeting IGF2BP2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11601-1-AP targets IGF2BP2 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse kidney tissue, rat kidney tissue, human kidney tissue, human heart tissue, COLO 320 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human pancreas cancer tissue, human breast cancer tissue, human colon cancer tissue, mouse stomach tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Insulin-like growth factor 2 mRNA-binding protein 2(IGF2BP2), ia a member of a family of mRNA binding protein, which can bind to several mammalian cells' mRNAs. Thus it may involve in the regulation of translation of mRNA. IGF2BP2's polymorphisms is risk factor for developing type 2 diabetes. This antibody raise against part of N-terminus of human IGF2BP2. IGF2BP2 has some isoforms with the MW of 54-66 kDa. Some literature has reported that multiple bands can be detected (PMID: 22427968, 36322753, 23069990). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2142 Product name: Recombinant human IGF2BP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-341 aa of BC021290 Sequence: MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIM Predict reactive species Full Name: insulin-like growth factor 2 mRNA binding protein 2 Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC021290 Gene Symbol: IGF2BP2 Gene ID (NCBI): 10644 RRID: AB_2122672 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6M1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924