Iright
BRAND / VENDOR: Proteintech

Proteintech, 11609-1-AP, CPSF3 Polyclonal antibody

CATALOG NUMBER: 11609-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CPSF3 (11609-1-AP) by Proteintech is a Polyclonal antibody targeting CPSF3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 11609-1-AP targets CPSF3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: C2C12 cells, HEK-293 cells, HepG2 cells, human brain tissue, HeLa cells, Jurkat cells, NIH/3T3 cells, RAW 264.7 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: mouse kidney tissue, human placenta tissue, human thyroid cancer tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CPSF3 (cleavage and polyadenylation specificity factor 3) is involved in human disease and is the putative target of benzoxaboroles in trypanosomatid parasites and Cryptosporidium infection. CPSF3 has also been associated with cancer malignancy in that CPSF3 induces cell cycle arrest in hepatocellular carcinoma and promotes lung adenocarcinoma cell proliferation and metastasis (PMID: 38718887). CPSF3 has been implicated in various cancers, including lung cancer, colorectal, prostate, and triple-negative breast cancers (PMID: 37627085). Specification Tested Reactivity: human, mouse Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2173 Product name: Recombinant human CPSF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 337-684 aa of BC020211 Sequence: SRELFESWCTDKRNGVIIAGYCVEGTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGEQNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQRVSGILVKRNFNYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH Predict reactive species Full Name: cleavage and polyadenylation specific factor 3, 73kDa Calculated Molecular Weight: 684 aa, 77 kDa Observed Molecular Weight: 77 kDa GenBank Accession Number: BC020211 Gene Symbol: CPSF3 Gene ID (NCBI): 51692 RRID: AB_2292188 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKF6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924