Iright
BRAND / VENDOR: Proteintech

Proteintech, 11627-1-AP, EPSTI1 Polyclonal antibody

CATALOG NUMBER: 11627-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPSTI1 (11627-1-AP) by Proteintech is a Polyclonal antibody targeting EPSTI1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 11627-1-AP targets EPSTI1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HUVEC cells, mouse spleen tissue Positive IHC detected in: human breast cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Real-time PCR revealed the highest expression in the placenta; strong expression in the small intestine, spleen, salivary gland, and testes; and low expression levels in normal breast and several other tissues. The expression of EPSTI1 was upregulated (range 5.6-72.1) in all 14 breast carcinomas tested. Microdissection revealed that both tumor and stromal tissue overexpressed EPSTI1. (PubMed: 11991720) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2157 Product name: Recombinant human EPSTI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC023660 Sequence: MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNRAKPVHLVPRRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMKAIQREKSNKLEEKKRLQENLRREAFREHQQYKTAEFLSKLNTESPDRSACQSAVCGPQSSTWKLPILPRDHSWARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGGLE Predict reactive species Full Name: epithelial stromal interaction 1 (breast) Calculated Molecular Weight: 410 aa, 47 kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC023660 Gene Symbol: EPSTI1 Gene ID (NCBI): 94240 RRID: AB_2877786 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96J88 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924