Iright
BRAND / VENDOR: Proteintech

Proteintech, 11651-1-AP, PPIH Polyclonal antibody

CATALOG NUMBER: 11651-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPIH (11651-1-AP) by Proteintech is a Polyclonal antibody targeting PPIH in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11651-1-AP targets PPIH in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U2OS cells, K-562 cells, PC-3 cells, mouse colon tissue, rat colon tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information PPIH(Peptidyl-prolyl cis-trans isomerase H) is also named as CYP20, CYPH and belongs to cyclophilin-type PPIase family, PPIase H subfamily.It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may act as a chaperone(PMID:12875835). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2253 Product name: Recombinant human PPIH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-177 aa of BC003412 Sequence: MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM Predict reactive species Full Name: peptidylprolyl isomerase H (cyclophilin H) Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC003412 Gene Symbol: PPIH Gene ID (NCBI): 10465 RRID: AB_2284306 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43447 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924