Proteintech, 11657-1-AP, INTS9 Polyclonal antibody

Size: 20ul / 150ul The INTS9 (11657-1-AP) by Proteintech is a Polyclonal antibody targeting INTS9 in WB, IHC, IP, ELISA applications with reactivity to human samples 11657-1-AP targets INTS9 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells Positive IP detected in: HeLa cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information INTS9, also known as Integrator Complex Subunit 9, is part of the core cleavage module consisting of INTS4/INTS9/INTS11 involved in processing small nuclear RNA (snRNA) molecules. It is a subunit of the Integrator complex, which comprises 15 subunits (including INTS6L), and plays a crucial role in the 3' end processing of snRNAs. By participating in the biogenesis of snRNAs, INTS9 contributes to the proper functioning of the spliceosome, a cellular machinery responsible for the accurate splicing of precursor messenger RNA (pre-mRNA) molecules. This process is essential for generating mature messenger RNA (mRNA), which is subsequently translated into functional proteins. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2226 Product name: Recombinant human INTS9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 309-658 aa of BC025267 Sequence: LECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF Predict reactive species Full Name: integrator complex subunit 9 Calculated Molecular Weight: 658 aa, 74 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC025267 Gene Symbol: INTS9 Gene ID (NCBI): 55756 RRID: AB_2127514 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NV88 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.