Proteintech, 11663-1-AP, VDAC1/2/3 Polyclonal antibody

Size: 20ul / 150ul The VDAC1/2/3 (11663-1-AP) by Proteintech is a Polyclonal antibody targeting VDAC1/2/3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11663-1-AP targets VDAC1/2/3 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human heart tissue, mouse heart tissue, rat brain tissue, rat heart tissue Positive IHC detected in: human prostate cancer tissue, human normal colon, human prostate tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:1200 Background Information VDACs (Voltage Dependent Anion selective Channels), also known as mitochondrial porins, are a family of pore-forming proteins discovered in the mitochondrial outer membrane. Mammals show a conserved genetic organization of the VDAC genes. It's reported that the amount of VDAC transcripts in liver is usually lower than in the other tissues. VDAC2 and expecially VDAC3 are highly expressed in testis, while mouse VDAC1 is poorly expressed in this tissue.(PMID: 22020053) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, duck Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2266 Product name: Recombinant human VDAC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-294 aa of BC000165 Sequence: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA Predict reactive species Full Name: voltage-dependent anion channel 2 Calculated Molecular Weight: 294 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC000165 Gene Symbol: VDAC2 Gene ID (NCBI): 7417 RRID: AB_2304144 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P45880 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.