Proteintech, 11666-1-AP, WSB1 Polyclonal antibody

Size: 20ul / 150ul The WSB1 (11666-1-AP) by Proteintech is a Polyclonal antibody targeting WSB1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 11666-1-AP targets WSB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, HepG2 cells, SMMC-7721 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information WSB1 (or SWIP1) gene encodes WD repeat and SOCS box-containing protein 1, a member of the WD-protein subfamily. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding 3 distinct isoforms have been found for this gene. WSB1 serves as a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WSB1 has been reported (PMID: 15965468), initiated by the interaction of the two components (PMID: 18093972). WSB1 is also a part of an E3 ubiquitin ligase for the thyroid-hormone-activating type 2 iodothyronine deiodinase (D2) (PMID: 15965468). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2211 Product name: Recombinant human WSB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC021110 Sequence: MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRV Predict reactive species Full Name: WD repeat and SOCS box-containing 1 Calculated Molecular Weight: 421 aa, 47 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC021110 Gene Symbol: WSB1 Gene ID (NCBI): 26118 RRID: AB_10949076 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6I7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.