Iright
BRAND / VENDOR: Proteintech

Proteintech, 11685-1-AP, PLEK2 Polyclonal antibody

CATALOG NUMBER: 11685-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLEK2 (11685-1-AP) by Proteintech is a Polyclonal antibody targeting PLEK2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 11685-1-AP targets PLEK2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, U2OS cells, Caco-2 cells, PC-3 cells Positive IP detected in: HT-29 cells Positive IHC detected in: human pancreas cancer tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HT-29 cells Positive FC (Intra) detected in: HT-29 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information PLEK2 belongs to the Pleckstrin homology domain family and is a 40-kDa protein containing the prototypic PH domains at its amino and carboxyl termini(PMID: 10419454). PLEK2 associates with membrane-bound phosphatidylinositols generated by phosphatidylinositol 3-kinase. PLEK2 interacts with the actin cytoskeleton to induce cell spreading. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2297 Product name: Recombinant human PLEK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-353 aa of BC001226 Sequence: EERDAWAFEITGAIHAGQPGKVQQLHSLRNSFKLPPHISLHRIVDKMHDSNTGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT Predict reactive species Full Name: pleckstrin 2 Calculated Molecular Weight: 353 aa, 40 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC001226 Gene Symbol: PLEK2 Gene ID (NCBI): 26499 RRID: AB_2252364 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYT0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924