Proteintech, 11686-1-AP, HMGN4 Polyclonal antibody

Size: 20ul / 150ul The HMGN4 (11686-1-AP) by Proteintech is a Polyclonal antibody targeting HMGN4 in WB, IF/ICC, ELISA applications with reactivity to human samples 11686-1-AP targets HMGN4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information HMGN4, also named as High mobility group nucleosome-binding domain-containing protein 4, is a 90 amino acid protein, which belongs to the HMGN family. HMGN4 as a DNA-binding protein localizes in the nucleus. The calculated molecular weight of HMGN4 is 10 kDa, but the modified HMGN4 protein is about 15 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2298 Product name: Recombinant human HMGN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC001282 Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK Predict reactive species Full Name: high mobility group nucleosomal binding domain 4 Calculated Molecular Weight: 90 aa, 10 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC001282 Gene Symbol: HMGN4 Gene ID (NCBI): 10473 RRID: AB_2118489 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00479 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.