Iright
BRAND / VENDOR: Proteintech

Proteintech, 11693-1-AP, GNG2 Polyclonal antibody

CATALOG NUMBER: 11693-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GNG2 (11693-1-AP) by Proteintech is a Polyclonal antibody targeting GNG2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11693-1-AP targets GNG2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Gγ2 subunit (Gng2/GNG2) is one of subunits of the Gβγ-dimer composing heterotrimeric G protein with a Gα-subunit. Heterotrimeric G protein has been reported to be involved in various biological activities including cell proliferation, differentiation, invasion and angiogenesis. It is expressed in a range of foetal tissues as well as adult testis, adrenal gland, brain, white blood cells and lung. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2307 Product name: Recombinant human GNG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-71 aa of BC020774 Sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL Predict reactive species Full Name: guanine nucleotide binding protein (G protein), gamma 2 Calculated Molecular Weight: 71 aa, 8 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: BC020774 Gene Symbol: GNG2 Gene ID (NCBI): 54331 RRID: AB_2263277 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P59768 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924