Iright
BRAND / VENDOR: Proteintech

Proteintech, 11734-1-AP, EID1 Polyclonal antibody

CATALOG NUMBER: 11734-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EID1 (11734-1-AP) by Proteintech is a Polyclonal antibody targeting EID1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 11734-1-AP targets EID1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells, U-937 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information EID1(EP300 interacting inhibitor of differentiation 1) is a member of the EID protein family, which regulates differentiation, transcription and acetyltransferase activity. EID1 function was originally identified as a transcriptional repressor which regulates cell cycle and differentiation, and leads to genome inactivation and instability by interacting with E3 ubiquitin ligase MDM2. EID1 is mainly located in the cytoplasm. It was translocated into the nuclei under stressed or pathological conditions such as AD patients and APP Tg mice brains.(PMID: 22186421, PMID: 31381951,PMID: 30926163). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2336 Product name: Recombinant human EID1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC024151 Sequence: MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE Predict reactive species Full Name: EP300 interacting inhibitor of differentiation 1 Calculated Molecular Weight: 187 aa, 21 kDa Observed Molecular Weight: 20-30 kDa GenBank Accession Number: BC024151 Gene Symbol: EID1 Gene ID (NCBI): 23741 RRID: AB_10640804 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6B2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924