Proteintech, 11736-1-AP, RPP40 Polyclonal antibody

Size: 20ul / 150ul The RPP40 (11736-1-AP) by Proteintech is a Polyclonal antibody targeting RPP40 in WB, ELISA applications with reactivity to human, mouse, rat samples 11736-1-AP targets RPP40 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2341 Product name: Recombinant human RPP40 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC017871 Sequence: MNTGPYYFVKNLPLHELITPEFISTFIKKGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKK Predict reactive species Full Name: ribonuclease P/MRP 40kDa subunit Calculated Molecular Weight: 35 kDa, 41 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC017871 Gene Symbol: RPP40 Gene ID (NCBI): 10799 RRID: AB_2182364 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75818 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.