Product Description
Size: 20ul / 150ul
The ENOPH1 (11763-1-AP) by Proteintech is a Polyclonal antibody targeting ENOPH1 in WB, ELISA applications with reactivity to human samples
11763-1-AP targets ENOPH1 in WB, IF, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: K-562 cells, HL-60 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
ENOPH1, also named as MASA and MSTP145, belongs to the HAD-like hydrolase superfamily and MasA/MtnC family. ENOPH1 is a newly identified enzyme involved in L-methionine biosynthesis, which is associated with anxiety and depression. Studies have shown that ENOPH1 plays a crucial role in promoting the proliferation and migration of glioma cells (PMID: 32654229). ENOPH1 has 2 isoforms with the molecular mass of 13 and 29 kDa.
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag2360 Product name: Recombinant human ENOPH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC001317 Sequence: MKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST Predict reactive species
Full Name: enolase-phosphatase 1
Calculated Molecular Weight: 13 kDa / 29 kDa
Observed Molecular Weight: 29-35 kDa
GenBank Accession Number: BC001317
Gene Symbol: ENOPH1
Gene ID (NCBI): 58478
RRID: AB_10794441
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UHY7
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924