Proteintech, 11771-1-AP, CYP4B1 Polyclonal antibody

Size: 20ul / 150ul The CYP4B1 (11771-1-AP) by Proteintech is a Polyclonal antibody targeting CYP4B1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11771-1-AP targets CYP4B1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, A549 cells, rat kidney tissue Positive IP detected in: mouse lung tissue Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1500 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2416 Product name: Recombinant human CYP4B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-512 aa of BC017758 Sequence: SYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWPDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQLVLRSKNGFHLHLKPLGPGSGK Predict reactive species Full Name: cytochrome P450, family 4, subfamily B, polypeptide 1 Calculated Molecular Weight: 512 aa, 59 kDa Observed Molecular Weight: 55-59 kDa GenBank Accession Number: BC017758 Gene Symbol: CYP4B1 Gene ID (NCBI): 1580 RRID: AB_11182944 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13584 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.