Iright
BRAND / VENDOR: Proteintech

Proteintech, 11787-1-AP, MPZL2 Polyclonal antibody

CATALOG NUMBER: 11787-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MPZL2 (11787-1-AP) by Proteintech is a Polyclonal antibody targeting MPZL2 in WB, ELISA applications with reactivity to human, mouse, rat samples 11787-1-AP targets MPZL2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HaCaT cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information MPZL2 (myelin protein zero-like 2), also named as EVA (epithelial V-like antigen) or EVA1, is a type 1 transmembrane protein of the myelin P0 protein family, containing an Ig-like V-type (immunoglobulin-like) domain and two potential glycosylation sites. MPZL2 is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2419 Product name: Recombinant human MPZL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC017774 Sequence: MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD Predict reactive species Full Name: myelin protein zero-like 2 Calculated Molecular Weight: 215 aa, 24 kDa Observed Molecular Weight: 24-30 kDa GenBank Accession Number: BC017774 Gene Symbol: MPZL2 Gene ID (NCBI): 10205 RRID: AB_2282054 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60487 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924