Iright
BRAND / VENDOR: Proteintech

Proteintech, 11790-1-AP, DIO1 Polyclonal antibody

CATALOG NUMBER: 11790-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DIO1 (11790-1-AP) by Proteintech is a Polyclonal antibody targeting DIO1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 11790-1-AP targets DIO1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, HeLa cells, mouse ovary tissue, rat lung tissue, U-937 cells, A549 cells Positive IHC detected in: human liver cancer tissue, human kidney tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information DIO1(Type I iodothyronine deiodinase) is also named as ITDI1, TXDI1,5DI,DIOI and belongs to the iodothyronine deiodinase family.It is a membrane selenoprotein that catalyzes the deiodination of L-thyroxine to the biologically active thyroid hormone 3,3′,5-triiodothyronine.DIO1 is located in liver, kidney, and thyroid,which has both ORD and IRD activities(PMID: 9389495). It has some isoforms produced by alternative splicing with the MW of 29 kDa, 21 kDa, 13 kDa, 23 kDa, 19 kDa, 4 kDa, 13 kDa, 9 kDa and 10 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2410 Product name: Recombinant human DIO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-125 aa of BC017955 Sequence: GLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT Predict reactive species Full Name: deiodinase, iodothyronine, type I Calculated Molecular Weight: 249 aa, 29 kDa Observed Molecular Weight: 29 kDa, 13 kDa GenBank Accession Number: BC017955 Gene Symbol: DIO1 Gene ID (NCBI): 1733 RRID: AB_10949197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49895 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924