Proteintech, 11794-1-AP, BET1 Polyclonal antibody

Size: 20ul / 150ul The BET1 (11794-1-AP) by Proteintech is a Polyclonal antibody targeting BET1 in WB, IHC, ELISA applications with reactivity to human samples 11794-1-AP targets BET1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, U-87 MG cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2261 Product name: Recombinant human BET1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC000899 Sequence: MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR Predict reactive species Full Name: blocked early in transport 1 homolog (S. cerevisiae) Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC000899 Gene Symbol: BET1 Gene ID (NCBI): 10282 RRID: AB_3085381 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15155 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.