Proteintech, 11802-1-AP, TOM20 Polyclonal antibody

Size: 20ul / 150ul The TOM20 (11802-1-AP) by Proteintech is a Polyclonal antibody targeting TOM20 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, chicken samples 11802-1-AP targets TOM20 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, chicken samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, mouse kidney tissue, rat kidney tissue, SH-SY5Y cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse brain tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HUVEC cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information BackgroundTOM20 (KIAA0016) belongs to the Tom family. It is a subunit of the mitochondrial import receptor (PMID: 7584026), whose main role is to translocate cytosolically synthesized mitochondrial proteins through the outer mitochondrial membrane and subsequently facilitate the movement of proteins into the TOM40 translocation pore complex (PMID: 21173275).What is the molecular weight of TOM20?It is a short 16.3 kDa protein containing several highly conserved regions, including the transmembrane segment, the ligand-binding domain, and flexible segments at the N terminus and the C terminus of the protein crucial for its function (PMID: 15733919).What is the subcellular localization of TOM20?It specifically localizes in the mitochondrial outer membrane. In malignant cells, strong granular staining in the cytoplasm has been observed.What is the tissue specificity of TOM20?It is ubiquitously expressed in various tissues, with a particularly high expression in the brain, thyroid, and pancreas.What is the function of TOM20 in the mitochondrial membrane?Mitochondrial preproteins are generally synthesized in the cytoplasm with signal or targeting sequences, which are recognized by specific receptors on the outer mitochondrial membrane. TOM20, as one of the components of the TOM40 complex, specifically recognizes pre-sequences on target proteins or their unfolded forms. In addition to its translocase activity, TOM20 may act as a chaperone preventing these proteins from aggregation at the surface of mitochondria (PMID: 14699115).What is TOM20's involvement in disease?Diseases linked to the misregulation of TOM20 include Perry Syndrome and neurodegeneration with brain iron accumulation 2A. Numerous studies also associate deregulation of TOM20 with an array of mitochondrial dysfunctions and mitophagy defects (PMIDs: 30254015, 30160596). Specification Tested Reactivity: human, mouse, rat, chicken Cited Reactivity: human, mouse, rat, pig, rabbit, monkey, chicken, zebrafish, hamster, cattle Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2378 Product name: Recombinant human TOM20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC000882 Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE Predict reactive species Full Name: translocase of outer mitochondrial membrane 20 homolog (yeast) Calculated Molecular Weight: 145 aa, 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC000882 Gene Symbol: TOM20 Gene ID (NCBI): 9804 RRID: AB_2207530 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15388 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.