Proteintech, 11829-1-AP, ARPP-21 Polyclonal antibody

Size: 20ul / 150ul The ARPP-21 (11829-1-AP) by Proteintech is a Polyclonal antibody targeting ARPP-21 in WB, IHC, ELISA applications with reactivity to human, mouse samples 11829-1-AP targets ARPP-21 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MOLT-4 cells, mouse brain tissue Positive IHC detected in: mouse brain tissue, human cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information ARPP-21 is a neuron-enriched signaling protein that was first purified and characterized from dopamine-rich regions of the mammalian brain, particularly the bovine caudate nucleus. It exists as two isoforms, ARPP-21A and ARPP-21B, generated by alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2399 Product name: Recombinant human ARPP-21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC017805 Sequence: MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQTL Predict reactive species Full Name: cyclic AMP-regulated phosphoprotein, 21 kD Calculated Molecular Weight: 89 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC017805 Gene Symbol: ARPP-21 Gene ID (NCBI): 10777 RRID: AB_2877798 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBL0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.