Iright
BRAND / VENDOR: Proteintech

Proteintech, 11837-1-AP, OLR1/LOX1 Polyclonal antibody

CATALOG NUMBER: 11837-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OLR1/LOX1 (11837-1-AP) by Proteintech is a Polyclonal antibody targeting OLR1/LOX1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 11837-1-AP targets OLR1/LOX1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: bEnd.3 cells, human liver tissue Positive IP detected in: L02 cells Positive IHC detected in: human heart tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information OLR1/LOX-1 acts as a receptor, in the form of homodimer, that mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein (oxLDL) (PMID: 9052782, 15695803). ORL1 is predominantly expressed in endothelial cells and vascular-rich organs such as the placenta, lung, liver, and brain (PMID: 9828121). OLR1 is a protein containing 273 amino acids with a calculated molecular mass of 31 kDa but an apparent molecular mass of 50 kDa, which may result from the glycosylation of four potential N-linked glycosylation sites located at the C-terminal domain (PMID: 9052782). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2437 Product name: Recombinant human OLR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC022295 Sequence: MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ Predict reactive species Full Name: oxidized low density lipoprotein (lectin-like) receptor 1 Calculated Molecular Weight: 273 aa, 31 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC022295 Gene Symbol: OLR1 Gene ID (NCBI): 4973 RRID: AB_2299037 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78380 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924